Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG4D Peptide - middle region

ATG4D Peptide - middle region

Product Specifications

Product Name Alternative

APG4-D, APG4D, AUTL4

UniProt

Q86TL0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG4D Rabbit Polyclonal Antibody (orb331005) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116274

Preservative

Lyophilized powder

AA Sequence

AQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKAGDWYGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSM1 3'UTR GFP Stable Cell Line
TU050204 1.0 mL

ACSM1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Cplx2 (NM_009946) Mouse Tagged Lenti ORF Clone
MR226092L3 10 µg

Cplx2 (NM_009946) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Polyclonal PAK6 Antibody
APR17744G 0.1mg

Polyclonal PAK6 Antibody

Sign In for Pricing
View Details
Reagecon Titanium Standard for ICP, ICP-MS 10,000 μg/mL (10,000 ppm) in 20% Hydrochloric Acid (HCl)
PTI4B5 250 mL

Reagecon Titanium Standard for ICP, ICP-MS 10,000 μg/mL (10,000 ppm) in 20% Hydrochloric Acid (HCl)

Sign In for Pricing
View Details
Ebola virus EBOV (Sudan ebolavirus, strain Gulu) Nucleoprotein/NP Protein (His)
TMPY-00308-01 5 µg

Ebola virus EBOV (Sudan ebolavirus, strain Gulu) Nucleoprotein/NP Protein (His)

Sign In for Pricing
View Details
Ebola virus EBOV (Sudan ebolavirus, strain Gulu) Nucleoprotein/NP Protein (His)
TMPY-00308-02 10 µg

Ebola virus EBOV (Sudan ebolavirus, strain Gulu) Nucleoprotein/NP Protein (His)

Sign In for Pricing
View Details