Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG5 Peptide - middle region

ATG5 Peptide - middle region

Product Specifications

Product Name Alternative

APG5, APG5-LIKE, APG5L, ASP, hAPG5

UniProt

Q9H1Y0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG5 Rabbit Polyclonal Antibody (orb331014) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004840

Preservative

Lyophilized powder

AA Sequence

RFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA Kit
MBS9308362 Inquire

Rabbit Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA Kit

Sign In for Pricing
View Details
Chicken Galectin-2 (LGALS2) ELISA Kit
MBS7220098-01 48 Well

Chicken Galectin-2 (LGALS2) ELISA Kit

Sign In for Pricing
View Details
Chicken Galectin-2 (LGALS2) ELISA Kit
MBS7220098-02 96 Well

Chicken Galectin-2 (LGALS2) ELISA Kit

Sign In for Pricing
View Details
Chicken Galectin-2 (LGALS2) ELISA Kit
MBS7220098-03 5x 96 Well

Chicken Galectin-2 (LGALS2) ELISA Kit

Sign In for Pricing
View Details
Chicken Galectin-2 (LGALS2) ELISA Kit
MBS7220098-04 10x 96 Well

Chicken Galectin-2 (LGALS2) ELISA Kit

Sign In for Pricing
View Details
PAX5 Rabbit Polyclonal Antibody
orb13639-01 50 μL

PAX5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details