What is the catalog number for ATOH8 Peptide - C-terminal region?

The catalog number for ATOH8 Peptide - C-terminal region is orb2011656.

What sizes are available for ATOH8 Peptide - C-terminal region?

ATOH8 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is ATOH8 Peptide - C-terminal region in stock?

ATOH8 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

ATOH8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ14708, FLJ38730, HATH6, bHLHa21

UniProt

Q96SQ7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_116216

Preservative

Lyophilized powder

AA Sequence

LRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RC207938 10 µg

FAM80A (RIMKLA) (NM_173642) Human Tagged ORF Clone

Sign In for Pricing

View Details

18896055 1.0 mL

ECI2 Adenovirus (Mouse)

Sign In for Pricing

View Details

MBS7618500-01 48 Well

Mouse MSP/MST1 (Hepatocyte growth factor-like protein) QuickTest ELISA Kit

Sign In for Pricing

View Details

MBS7618500-02 96 Well

Mouse MSP/MST1 (Hepatocyte growth factor-like protein) QuickTest ELISA Kit

Sign In for Pricing

View Details

MBS7618500-03 5x 96 Well

Mouse MSP/MST1 (Hepatocyte growth factor-like protein) QuickTest ELISA Kit

Sign In for Pricing

View Details

MBS7618500-04 10x 96 Well

Mouse MSP/MST1 (Hepatocyte growth factor-like protein) QuickTest ELISA Kit

Sign In for Pricing

View Details