Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATOH8 Peptide - C-terminal region

ATOH8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ14708, FLJ38730, HATH6, bHLHa21

UniProt

Q96SQ7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_116216

Preservative

Lyophilized powder

AA Sequence

LRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Protein Kinase A regulatory subunit I alpha Antibody
NBP3-35902-20ul 20 µL

Rabbit Polyclonal Protein Kinase A regulatory subunit I alpha Antibody

Sign In for Pricing
View Details
XRN2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV620861 1.0 µg DNA

XRN2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
B18R, Vaccinia virus (HEK293, His)
HY-P70015-01 2 µg

B18R, Vaccinia virus (HEK293, His)

Sign In for Pricing
View Details
B18R, Vaccinia virus (HEK293, His)
HY-P70015-02 10 µg

B18R, Vaccinia virus (HEK293, His)

Sign In for Pricing
View Details
B18R, Vaccinia virus (HEK293, His)
HY-P70015-03 50 µg

B18R, Vaccinia virus (HEK293, His)

Sign In for Pricing
View Details
Gm13139 siRNA Oligos set (Mouse)
21790174 3x 5 nmol

Gm13139 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details