Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATOH8 Peptide - C-terminal region

ATOH8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ14708, FLJ38730, HATH6, bHLHa21

UniProt

Q96SQ7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_116216

Preservative

Lyophilized powder

AA Sequence

LRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRP-L9 Rabbit Polyclonal Antibody
APRab14139-01 20 µL

MRP-L9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRP-L9 Rabbit Polyclonal Antibody
APRab14139-02 50 µL

MRP-L9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRP-L9 Rabbit Polyclonal Antibody
APRab14139-03 100 µL

MRP-L9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRP-L9 Rabbit Polyclonal Antibody
APRab14139-04 200 µL

MRP-L9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Zwilch Pre-designed siRNA Set B
SI216576B 1 Each

Rat Zwilch Pre-designed siRNA Set B

Sign In for Pricing
View Details
1- (7,8-Diamino-1,2,4,5-tetrahydro-1,5-methano-3H-3-benzazepin-3-yl) -2,2,2-trifluoroethanone
271033-01 500 mg

1- (7,8-Diamino-1,2,4,5-tetrahydro-1,5-methano-3H-3-benzazepin-3-yl) -2,2,2-trifluoroethanone

Sign In for Pricing
View Details