Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATOH8 Peptide - C-terminal region

ATOH8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ14708, FLJ38730, HATH6, bHLHa21

UniProt

Q96SQ7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_116216

Preservative

Lyophilized powder

AA Sequence

LRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fkbp1a (NM_008019) Mouse Tagged ORF Clone Lentiviral Particle
MR200405L2V 200 µL

Fkbp1a (NM_008019) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MCTP2 (m) -PR
sc-149330-PR 10 µM - 20 µL

MCTP2 (m) -PR

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Lipid A export ATP-binding/permease protein MsbA (msbA)
MBS7020957-01 0.02 mg

Recombinant Yersinia pestis bv. Antiqua Lipid A export ATP-binding/permease protein MsbA (msbA)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Lipid A export ATP-binding/permease protein MsbA (msbA)
MBS7020957-02 0.1 mg

Recombinant Yersinia pestis bv. Antiqua Lipid A export ATP-binding/permease protein MsbA (msbA)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Lipid A export ATP-binding/permease protein MsbA (msbA)
MBS7020957-03 5x 0.1 mg

Recombinant Yersinia pestis bv. Antiqua Lipid A export ATP-binding/permease protein MsbA (msbA)

Sign In for Pricing
View Details
OATA00190-100T - Human CD5 Antibody : FITC
OATA00190-100T 100 Tests

OATA00190-100T - Human CD5 Antibody : FITC

Sign In for Pricing
View Details