Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATOH8 Peptide - C-terminal region

ATOH8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ14708, FLJ38730, HATH6, bHLHa21

UniProt

Q96SQ7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_116216

Preservative

Lyophilized powder

AA Sequence

LRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FineTest®700 Anti-Rat CD45 Antibody (OX-1)
F700-30009-01 50 Tests

FineTest®700 Anti-Rat CD45 Antibody (OX-1)

Sign In for Pricing
View Details
FineTest®700 Anti-Rat CD45 Antibody (OX-1)
F700-30009-02 100 Tests

FineTest®700 Anti-Rat CD45 Antibody (OX-1)

Sign In for Pricing
View Details
PCMTD2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV713156 1.0 µg DNA

PCMTD2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Human AK1 Protein, His (Fc)-Avi-tagged
AK1-300H 50 µg

Recombinant Human AK1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Atp7a (NM_001109757) Mouse Tagged Lenti ORF Clone
MR225904L3 10 µg

Atp7a (NM_001109757) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RAB11FIP5 Antibody
E51A13307 100 µL

RAB11FIP5 Antibody

Sign In for Pricing
View Details