Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp10d Peptide - middle region

Atp10d Peptide - middle region

Product Specifications

Product Name Alternative

Atp10d

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atp10d Rabbit Polyclonal Antibody (orb580765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_002725021

Preservative

Lyophilized powder

AA Sequence

YAKRGLRTLCVAKKVMSDTEYAEWLRNHFLAETSIDNREELLVESAMRLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aromatase Polyclonal Antibody, HRP Conjugated
bs-0114M-HRP-01 20 µL

Aromatase Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Aromatase Polyclonal Antibody, HRP Conjugated
bs-0114M-HRP-02 100 µL

Aromatase Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
MARCH8 shRNA Plasmid (m)
sc-149271-SH 20 µg

MARCH8 shRNA Plasmid (m)

Sign In for Pricing
View Details
IRF3 (pS385) Blocking Peptide
MBS8243334-01 1 mg

IRF3 (pS385) Blocking Peptide

Sign In for Pricing
View Details
IRF3 (pS385) Blocking Peptide
MBS8243334-02 5 mg

IRF3 (pS385) Blocking Peptide

Sign In for Pricing
View Details
IRF3 (pS385) Blocking Peptide
MBS8243334-03 5x 5 mg

IRF3 (pS385) Blocking Peptide

Sign In for Pricing
View Details