Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp10d Peptide - middle region

Atp10d Peptide - middle region

Product Specifications

Product Name Alternative

Atp10d

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atp10d Rabbit Polyclonal Antibody (orb580765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_002725021

Preservative

Lyophilized powder

AA Sequence

YAKRGLRTLCVAKKVMSDTEYAEWLRNHFLAETSIDNREELLVESAMRLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Proliferating cell nuclear antigen antibody (PCNA) ELISA Kit
orb1668831-01 48 Tests

Human Proliferating cell nuclear antigen antibody (PCNA) ELISA Kit

Sign In for Pricing
View Details
Human Proliferating cell nuclear antigen antibody (PCNA) ELISA Kit
orb1668831-02 96 Tests

Human Proliferating cell nuclear antigen antibody (PCNA) ELISA Kit

Sign In for Pricing
View Details
Olr537 ORF Vector (Rat) (pORF)
ORF072592 1.0 µg DNA

Olr537 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
OSGIN1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1575002 1.0 µg DNA

OSGIN1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Phospho-NF kappaB p65 (Ser311) Antibody
MBS9601158-01 0.1 mL

Phospho-NF kappaB p65 (Ser311) Antibody

Sign In for Pricing
View Details
Phospho-NF kappaB p65 (Ser311) Antibody
MBS9601158-02 0.2 mL

Phospho-NF kappaB p65 (Ser311) Antibody

Sign In for Pricing
View Details