Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp11c Peptide - C-terminal region

Atp11c Peptide - C-terminal region

Product Specifications

Product Name Alternative

A330005H02Rik, AI315324, Ig, MGC117487

UniProt

Q9QZW0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atp11c Rabbit Polyclonal Antibody (orb579227) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032952

Preservative

Lyophilized powder

AA Sequence

GLKVWVLTGDKMETAKSTCYACRLFQTNTELLELTTKTIEESERKEDRLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Trp (Boc) TentaGel® S TRT Resin
SA1228.1G 1 g

Fmoc-Trp (Boc) TentaGel® S TRT Resin

Sign In for Pricing
View Details
DYRK3 (N-term) Rabbit Polyclonal Antibody
AP14166PU-N 400 µL

DYRK3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Adam8 activation kit by CRISPRa
GA200071 1 Kit

Mouse Adam8 activation kit by CRISPRa

Sign In for Pricing
View Details
MYF5 Rabbit Polyclonal Antibody
AP20410PU-N 100 µg

MYF5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDPK1 Rabbit Polyclonal Antibody
AP02549PU-N 100 µL

PDPK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C20orf151 (RBBP8NL) (NM_080833) Human Recombinant Protein
TP312450L 1 mg

C20orf151 (RBBP8NL) (NM_080833) Human Recombinant Protein

Sign In for Pricing
View Details