Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp1b2 Peptide - N-terminal region

Atp1b2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Amog, Atpb-2

UniProt

P14231

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atp1b2 Rabbit Polyclonal Antibody (orb579394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038201

Preservative

Lyophilized powder

AA Sequence

WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monodocosahexaenoin
TRC-M539553-10MG 10 mg

Monodocosahexaenoin

Sign In for Pricing
View Details
Aprataxin (APTX) (NM_001195250) Human Over-expression Lysate
LC434146 20 µg

Aprataxin (APTX) (NM_001195250) Human Over-expression Lysate

Sign In for Pricing
View Details
APPL (APPL1) Mouse Monoclonal Antibody [Clone ID: OTI4B11]
CF807768 100 µg

APPL (APPL1) Mouse Monoclonal Antibody [Clone ID: OTI4B11]

Sign In for Pricing
View Details
Peroxiredoxin 2 (PRDX2) (NM_005809) Human Recombinant Protein
TP307413L 1 mg

Peroxiredoxin 2 (PRDX2) (NM_005809) Human Recombinant Protein

Sign In for Pricing
View Details
GBP6 Antibody
KC-12141-01 50 μL

GBP6 Antibody

Sign In for Pricing
View Details
GBP6 Antibody
KC-12141-02 100 µL

GBP6 Antibody

Sign In for Pricing
View Details