Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp1b2 Peptide - N-terminal region

Atp1b2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Amog, Atpb-2

UniProt

P14231

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atp1b2 Rabbit Polyclonal Antibody (orb579394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038201

Preservative

Lyophilized powder

AA Sequence

WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAD3 Recombinant Rabbit Monoclonal Antibody [JE48-14]
ET7109-76 100 µL

MAD3 Recombinant Rabbit Monoclonal Antibody [JE48-14]

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2836), CF594 conjugate, 0.1mg/mL
BNC942836-500 1x 500 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2836), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IGF2BP3 Antibody
KC-1256-01 50 μL

IGF2BP3 Antibody

Sign In for Pricing
View Details
IGF2BP3 Antibody
KC-1256-02 100 µL

IGF2BP3 Antibody

Sign In for Pricing
View Details
IGF2BP3 Antibody
KC-1256-03 1 mL

IGF2BP3 Antibody

Sign In for Pricing
View Details
RANTES (CCL5) (NM_002985) Human Recombinant Protein
TP303799L 1 mg

RANTES (CCL5) (NM_002985) Human Recombinant Protein

Sign In for Pricing
View Details