Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP1B4 Peptide - middle region

ATP1B4 Peptide - middle region

Product Specifications

UniProt

Q9UN42

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP1B4 Rabbit Polyclonal Antibody (orb579897) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036201

Preservative

Lyophilized powder

AA Sequence

ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KNG1 Antibody, Biotin conjugated
A45757-100UG 100 µg

KNG1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Phospho-HSP27 (Ser82) Polyclonal Antibody, PE Conjugated
bs-3180R-PE 100 µL

Phospho-HSP27 (Ser82) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Human Resistin Mutant
7-01526 10 µg

Recombinant Human Resistin Mutant

Sign In for Pricing
View Details
Recombinant Human DnaJ (Hsp40) Homolog, Subfamily B, Member 6
7-06934 1 µg

Recombinant Human DnaJ (Hsp40) Homolog, Subfamily B, Member 6

Sign In for Pricing
View Details
ZNF69 (Zinc Finger Protein 69, Cos5, hZNF3) (MaxLight 650)
MBS6225581-01 0.1 mL

ZNF69 (Zinc Finger Protein 69, Cos5, hZNF3) (MaxLight 650)

Sign In for Pricing
View Details
ZNF69 (Zinc Finger Protein 69, Cos5, hZNF3) (MaxLight 650)
MBS6225581-02 5x 0.1 mL

ZNF69 (Zinc Finger Protein 69, Cos5, hZNF3) (MaxLight 650)

Sign In for Pricing
View Details