Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp4b Peptide - C-terminal region

Atp4b Peptide - C-terminal region

Product Specifications

Product Name Alternative

S76401S1, Atp4b

UniProt

P18598

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atp4b Rabbit Polyclonal Antibody (orb579136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036642

Preservative

Lyophilized powder

AA Sequence

QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1576 (VAT1L) Human shRNA Plasmid Kit (Locus ID 57687)
TL307195 1 Kit

KIAA1576 (VAT1L) Human shRNA Plasmid Kit (Locus ID 57687)

Sign In for Pricing
View Details
TRAPPC2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62604R-BF405-01 20 µL

TRAPPC2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
TRAPPC2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62604R-BF405-02 100 µL

TRAPPC2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
SH3KBP1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV689784 1.0 µg DNA

SH3KBP1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Anti-Mitofusin 1/MFN1 Antibody Picoband®
PB9264 100 µg/Vial

Anti-Mitofusin 1/MFN1 Antibody Picoband®

Sign In for Pricing
View Details
Rat Stk40 Pre-designed siRNA Set A
SI213914A 1 Each

Rat Stk40 Pre-designed siRNA Set A

Sign In for Pricing
View Details