Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp4b Peptide - C-terminal region

Atp4b Peptide - C-terminal region

Product Specifications

Product Name Alternative

S76401S1, Atp4b

UniProt

P18598

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atp4b Rabbit Polyclonal Antibody (orb579136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036642

Preservative

Lyophilized powder

AA Sequence

QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RNA-binding motif protein, Y chromosome, family 1 member A1/C (RBMY1A1) ELISA Kit
abx541689 96 Tests

Human RNA-binding motif protein, Y chromosome, family 1 member A1/C (RBMY1A1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal ALK-1 Antibody (104) [DyLight 680]
NBP2-89256FR 0.1 mL

Rabbit Monoclonal ALK-1 Antibody (104) [DyLight 680]

Sign In for Pricing
View Details
CD326 polyclonal antibody
NCP0383P-01 50 µL

CD326 polyclonal antibody

Sign In for Pricing
View Details
CD326 polyclonal antibody
NCP0383P-02 100 µL

CD326 polyclonal antibody

Sign In for Pricing
View Details
B3GALT5 Recombinant Protein
OPCD01570-10UG 10 µg

B3GALT5 Recombinant Protein

Sign In for Pricing
View Details
Recombinant Rhodobacter capsulatus Uncharacterized protein RCAP_rcc01784 (RCAP_rcc01784)
MBS1190744-01 0.02 mg (E-Coli)

Recombinant Rhodobacter capsulatus Uncharacterized protein RCAP_rcc01784 (RCAP_rcc01784)

Sign In for Pricing
View Details