Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp5f1 Peptide - N-terminal region

Atp5f1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C76477

UniProt

Q9CQQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atp5f1 Rabbit Polyclonal Antibody (orb580323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033855

Preservative

Lyophilized powder

AA Sequence

PPLPEYGGKVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DODC (DiOC2 (5) ) (high purity)
#40040 1x 50 mg

DODC (DiOC2 (5) ) (high purity)

Sign In for Pricing
View Details
Monooctyl Phthalate Beta-D-Glucuronide
TRC-M566655-5MG 5 mg

Monooctyl Phthalate Beta-D-Glucuronide

Sign In for Pricing
View Details
SIGLEC11 (NM_052884) Human Over-expression Lysate
LY432355 100 µg

SIGLEC11 (NM_052884) Human Over-expression Lysate

Sign In for Pricing
View Details
Polystyrene AM SH
H40004.0.5G 5 g

Polystyrene AM SH

Sign In for Pricing
View Details
Human OSBPL5 activation kit by CRISPRa
GA114479 1 Kit

Human OSBPL5 activation kit by CRISPRa

Sign In for Pricing
View Details
Mfn1 Mouse Gene Knockout Kit (CRISPR)
KN310033 1 Kit

Mfn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details