Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp5f1 Peptide - N-terminal region

Atp5f1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C76477

UniProt

Q9CQQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atp5f1 Rabbit Polyclonal Antibody (orb580323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033855

Preservative

Lyophilized powder

AA Sequence

PPLPEYGGKVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf19 (TSEN15) (NM_052965) Human Recombinant Protein
TP305519M 100 µg

C1orf19 (TSEN15) (NM_052965) Human Recombinant Protein

Sign In for Pricing
View Details
ZNHIT2 (NM_014205) Human Recombinant Protein
TP308584L 1 mg

ZNHIT2 (NM_014205) Human Recombinant Protein

Sign In for Pricing
View Details
Human Collagen Type X (COL10) ELISA Kit
RDR-COL10-Hu-01 96 Tests

Human Collagen Type X (COL10) ELISA Kit

Sign In for Pricing
View Details
Human Collagen Type X (COL10) ELISA Kit
RDR-COL10-Hu-02 48 Tests

Human Collagen Type X (COL10) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS622251 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Ɑ-Azido-ω-Amino PEG
133000-20-5.1G 1 g

Ɑ-Azido-ω-Amino PEG

Sign In for Pricing
View Details