Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp6v0a1 Peptide - C-terminal region

Atp6v0a1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA959968, ATP6a1, Atp6n1, Atp6n1a, Atpv0a1, Vpp-1, Vpp1

UniProt

A2A5A0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atp6v0a1 Rabbit Polyclonal Antibody (orb576251) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_058616

Preservative

Lyophilized powder

AA Sequence

TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsp40 (DNAJB1) (NM_006145) Human Over-expression Lysate
LY401851 100 µg

Hsp40 (DNAJB1) (NM_006145) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ttr activation kit by CRISPRa
GA204486 1 Kit

Mouse Ttr activation kit by CRISPRa

Sign In for Pricing
View Details
Boc-L-cysteine
TRC-B619370-2G 2 g

Boc-L-cysteine

Sign In for Pricing
View Details
(S)-3-(Boc-amino)pyrrolidine
TRC-B621230-10MG 10 mg

(S)-3-(Boc-amino)pyrrolidine

Sign In for Pricing
View Details
SP3 (NM_001017371) Human Over-expression Lysate
LY400394 100 µg

SP3 (NM_001017371) Human Over-expression Lysate

Sign In for Pricing
View Details
Aurora B (AURKB) Rabbit Polyclonal Antibody
AP06597PU-N 100 µg

Aurora B (AURKB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details