Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp6v0a1 Peptide - C-terminal region

Atp6v0a1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA959968, ATP6a1, Atp6n1, Atp6n1a, Atpv0a1, Vpp-1, Vpp1

UniProt

A2A5A0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atp6v0a1 Rabbit Polyclonal Antibody (orb576251) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_058616

Preservative

Lyophilized powder

AA Sequence

TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Rplp0 activation kit by CRISPRa
GA200261 1 Kit

Mouse Rplp0 activation kit by CRISPRa

Sign In for Pricing
View Details
Bik Mouse Gene Knockout Kit (CRISPR)
KN502167 1 Kit

Bik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), CF594 conjugate, 0.1mg/mL
BNC941136-500 1x 500 µL

Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Acetylphenylboronic Acid
TRC-A188840-25G 25 g

4-Acetylphenylboronic Acid

Sign In for Pricing
View Details
OGG1 Recombinant Rabbit Monoclonal Antibody [JA18-13]
ET1704-79 100 µL

OGG1 Recombinant Rabbit Monoclonal Antibody [JA18-13]

Sign In for Pricing
View Details
5-(4-aminophenyl)-1,3,4-oxadiazole-2-thiol
TRC-A620840-250MG 250 mg

5-(4-aminophenyl)-1,3,4-oxadiazole-2-thiol

Sign In for Pricing
View Details