Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6V1C2 Peptide - C-terminal region

ATP6V1C2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATP6C2, VMA5

UniProt

A8KA87

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP6V1C2 Rabbit Polyclonal Antibody (orb585305) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653184

Preservative

Lyophilized powder

AA Sequence

SEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHANK3 Rabbit Polyclonal Antibody (BF350)
orb2537397 100 µL

SHANK3 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
PEG10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G10]
TA809524BM 100 µL

PEG10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G10]

Sign In for Pricing
View Details
IL3 Antibody
OABB00931-100UG 100 µg/Vial

IL3 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TLE1 Antibody (OTI1H2) [PE]
NBP2-74530PE 0.1 mL

Mouse Monoclonal TLE1 Antibody (OTI1H2) [PE]

Sign In for Pricing
View Details
RAMP1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-1567R-BF680-TR 20 µL

RAMP1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal OXPAT Antibody [Dylight 755]
NB110-60511IR 0.1 mL

Rabbit Polyclonal OXPAT Antibody [Dylight 755]

Sign In for Pricing
View Details