ATP8B2 Peptide - N-terminal region
ATP8B2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ATPID, DKFZp434M0219, KIAA1137
UniProt
P98198
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATP8B2 Rabbit Polyclonal Antibody (orb325160) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005855
Preservative
Lyophilized powder
AA Sequence
MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040896-500 1x 500 µL
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC430800 20 µg
BRCC45 (BRE) (NM_199194) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC402940-100 1x 100 µL
CD79b (B-Cell Marker) (IGB/2940R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 