Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP8B2 Peptide - N-terminal region

ATP8B2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ATPID, DKFZp434M0219, KIAA1137

UniProt

P98198

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP8B2 Rabbit Polyclonal Antibody (orb325160) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005855

Preservative

Lyophilized powder

AA Sequence

MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse 1700017L05Rik activation kit by CRISPRa
GA208157 1 Kit

Mouse 1700017L05Rik activation kit by CRISPRa

Sign In for Pricing
View Details
NCAM1 Antibody (Biotin)
KB-26815-01 50 μL

NCAM1 Antibody (Biotin)

Sign In for Pricing
View Details
NCAM1 Antibody (Biotin)
KB-26815-02 100 µL

NCAM1 Antibody (Biotin)

Sign In for Pricing
View Details
NCAM1 Antibody (Biotin)
KB-26815-03 1 mL

NCAM1 Antibody (Biotin)

Sign In for Pricing
View Details
MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: OTI6B12]
CF807226 100 µg

MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: OTI6B12]

Sign In for Pricing
View Details
Human SPDYE18 activation kit by CRISPRa
GA119284 1 Kit

Human SPDYE18 activation kit by CRISPRa

Sign In for Pricing
View Details