Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Auh Peptide - N-terminal region

Auh Peptide - N-terminal region

Product Specifications

Product Name Alternative

C77140, W91705

UniProt

Q9JLZ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Auh Rabbit Polyclonal Antibody (orb577553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057918

Preservative

Lyophilized powder

AA Sequence

PRRGYSSEVKTEDELRVRHLEEENRGIVVLGINRAYGKNALSKNLLKMLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 Rabbit Polyclonal Antibody
AP08083PU-S 50 µL

AKT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,2:5,6-Di-O-isopropylidene-Alpha-D-allofuranose
TRC-D455750-1G 1 g

1,2:5,6-Di-O-isopropylidene-Alpha-D-allofuranose

Sign In for Pricing
View Details
CCN2 Mouse Monoclonal Antibody [Clone ID: OTI5H7]
CF806803 100 µg

CCN2 Mouse Monoclonal Antibody [Clone ID: OTI5H7]

Sign In for Pricing
View Details
PP5 (PPP5C) Rabbit Polyclonal Antibody
AP05147PU-N 100 µg

PP5 (PPP5C) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADCY6 Human Gene Knockout Kit (CRISPR)
KN209021LP 1 Kit

ADCY6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SIGLEC6 Antibody
KC-7803-01 50 μL

SIGLEC6 Antibody

Sign In for Pricing
View Details