Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Auh Peptide - N-terminal region

Auh Peptide - N-terminal region

Product Specifications

Product Name Alternative

C77140, W91705

UniProt

Q9JLZ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Auh Rabbit Polyclonal Antibody (orb577553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057918

Preservative

Lyophilized powder

AA Sequence

PRRGYSSEVKTEDELRVRHLEEENRGIVVLGINRAYGKNALSKNLLKMLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX6 Antibody
F40243-0.08ML 0.08 mL

PAX6 Antibody

Sign In for Pricing
View Details
TSPAN4 (NM_001025239) Human Over-expression Lysate
LY422493 100 µg

TSPAN4 (NM_001025239) Human Over-expression Lysate

Sign In for Pricing
View Details
(3S,4aS,8aS)-Decahydroisoquinolinecarboxylic Acid, Hydrochloride Salt (90%)
TRC-D212130-500MG 500 mg

(3S,4aS,8aS)-Decahydroisoquinolinecarboxylic Acid, Hydrochloride Salt (90%)

Sign In for Pricing
View Details
COLEC12 Antibody
KC-2036-01 50 μL

COLEC12 Antibody

Sign In for Pricing
View Details
COLEC12 Antibody
KC-2036-02 100 µL

COLEC12 Antibody

Sign In for Pricing
View Details
COLEC12 Antibody
KC-2036-03 1 mL

COLEC12 Antibody

Sign In for Pricing
View Details