Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Avil Peptide - N-terminal region

Avil Peptide - N-terminal region

Product Specifications

UniProt

Q9WU06

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Avil Rabbit Polyclonal Antibody (orb573823) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077377

Preservative

Lyophilized powder

AA Sequence

SGERLXXXXXXKAMLLAKDIRDREGGGRAEIGVIEGDKEAASPELMTVLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clathrin, Heavy Chain (CHC/1432), 1mg/mL
BNUM1432-50 1x 50 µL

Clathrin, Heavy Chain (CHC/1432), 1mg/mL

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike S1 (T20N, D614G) (His Tag)
PKSV030377 100 µg

Recombinant SARS-CoV-2 Spike S1 (T20N, D614G) (His Tag)

Sign In for Pricing
View Details
Fast Plus EvaGreen® qPCR Master Mix with High Rox (trial size, 100 rxn)
#31015-T 1x 1 mL

Fast Plus EvaGreen® qPCR Master Mix with High Rox (trial size, 100 rxn)

Sign In for Pricing
View Details
Hpcal1 (NM_016677) Mouse Tagged ORF Clone
MG201858 10 µg

Hpcal1 (NM_016677) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD1 (CD1A) (NM_001763) Human Recombinant Protein
TP700275 20 µg

CD1 (CD1A) (NM_001763) Human Recombinant Protein

Sign In for Pricing
View Details
5-TAMRA azide
486-AAT 5 mg

5-TAMRA azide

Sign In for Pricing
View Details