Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Avil Peptide - N-terminal region

Avil Peptide - N-terminal region

Product Specifications

UniProt

Q9WU06

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Avil Rabbit Polyclonal Antibody (orb573823) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077377

Preservative

Lyophilized powder

AA Sequence

SGERLXXXXXXKAMLLAKDIRDREGGGRAEIGVIEGDKEAASPELMTVLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon
CR562966 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
CTNND1 (NM_001085461) Human Over-expression Lysate
LY421310 100 µg

CTNND1 (NM_001085461) Human Over-expression Lysate

Sign In for Pricing
View Details
5, 5'-Dimethyl BAPTA, tetrapotassium salt
#50008 1x 100 mg

5, 5'-Dimethyl BAPTA, tetrapotassium salt

Sign In for Pricing
View Details
Mesothelin (Mesothelial Marker) (MSLN/2131), CF740 conjugate, 0.1mg/mL
BNC742131-100 1x 100 µL

Mesothelin (Mesothelial Marker) (MSLN/2131), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
gamma Adducin (ADD3) (NM_016824) Human Over-expression Lysate
LC402581 20 µg

gamma Adducin (ADD3) (NM_016824) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Lumican Antibody
RC-5032-01 50 μL

Recombinant Lumican Antibody

Sign In for Pricing
View Details