Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AVPR1A Peptide - C-terminal region

AVPR1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

AVPR1

UniProt

P37288

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AVPR1A Rabbit Polyclonal Antibody (orb331204) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000697

Preservative

Lyophilized powder

AA Sequence

WIYMFFSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2-Nitrophenyl)hydrazine (Contains ~30-40% water as stabilizer)
TRC-N926130-250MG 250 mg

(2-Nitrophenyl)hydrazine (Contains ~30-40% water as stabilizer)

Sign In for Pricing
View Details
Phosphotyrosine (P-Tyr) (PY2870R), CF568 conjugate, 0.1mg/mL
BNC682870-500 1x 500 µL

Phosphotyrosine (P-Tyr) (PY2870R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Parathyroid Hormone Recombinant Rabbit monoclonal Antibody
HA723823 100 µL

Parathyroid Hormone Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cooled Incubator BICL-7906
BICL-7906 1 Unit

Cooled Incubator BICL-7906

Sign In for Pricing
View Details
Uhmk1 Mouse Gene Knockout Kit (CRISPR)
KN518684 1 Kit

Uhmk1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Genomic DNA, Kidney
CD565287 5 µg

Tissue Genomic DNA, Kidney

Sign In for Pricing
View Details