Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AVPR1A Peptide - C-terminal region

AVPR1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

AVPR1

UniProt

P37288

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AVPR1A Rabbit Polyclonal Antibody (orb331204) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000697

Preservative

Lyophilized powder

AA Sequence

WIYMFFSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat LCN2/NGAL Protein (His Tag)
PKSR030380 100 µg

Recombinant Rat LCN2/NGAL Protein (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS806404 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
SPIRE1 (NM_020148) Human Recombinant Protein
TP313848M 100 µg

SPIRE1 (NM_020148) Human Recombinant Protein

Sign In for Pricing
View Details
UBE2D2 Mouse Monoclonal Antibody [Clone ID: OTI1D2]
CF806505 100 µg

UBE2D2 Mouse Monoclonal Antibody [Clone ID: OTI1D2]

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (rB22.1), CF640R conjugate, 0.1mg/mL
BNC402175-100 1x 100 µL

Cytokeratin 8 (KRT8) (rB22.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA414 + CGA/777 + CGA/798), CF568 conjugate, 0.1mg/mL
BNC681060-500 1x 500 µL

Chromogranin A (CGA414 + CGA/777 + CGA/798), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details