Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AVPR1B Peptide - C-terminal region

AVPR1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

AVPR3

UniProt

P47901

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AVPR1B Rabbit Polyclonal Antibody (orb331207) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000698

Preservative

Lyophilized powder

AA Sequence

TISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Theropithecus gelada Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1), partial
MBS7084175 Inquire

Recombinant Theropithecus gelada Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1), partial

Sign In for Pricing
View Details
PsaD | PSI-D subunit of photosystem I (cyanobacterial)
AS19 4354 50 µL

PsaD | PSI-D subunit of photosystem I (cyanobacterial)

Sign In for Pricing
View Details
ACTR3P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV718229 1.0 µg DNA

ACTR3P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
DEDD1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-7062R-BF405 100 µL

DEDD1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse G-protein coupled receptor family C group 5 member D (Gprc5d)
orb2905566-01 20 µg

Recombinant Mouse G-protein coupled receptor family C group 5 member D (Gprc5d)

Sign In for Pricing
View Details
Recombinant Mouse G-protein coupled receptor family C group 5 member D (Gprc5d)
orb2905566-02 100 µg

Recombinant Mouse G-protein coupled receptor family C group 5 member D (Gprc5d)

Sign In for Pricing
View Details