What is the catalog number for AVPR2 Peptide - C-terminal region?

The catalog number for AVPR2 Peptide - C-terminal region is orb2011628.

What sizes are available for AVPR2 Peptide - C-terminal region?

AVPR2 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is AVPR2 Peptide - C-terminal region in stock?

AVPR2 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

AVPR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ADHR, DI1, DIR, DIR3, MGC126533, MGC138386, NDI, V2R

UniProt

P30518

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000045

Preservative

Lyophilized powder

AA Sequence

NPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb845627 2 mg

DED1 Antibody

Sign In for Pricing

View Details

24190014 1.0 µg DNA

Idh3b ORF Vector (Mouse) (pORF)

Sign In for Pricing

View Details

MPH01262 150 µL - 10 µM

hsa-miR-2110 Primers

Sign In for Pricing

View Details

MBS489356-01 0.2 mg

Anti-CD20 [1F5], Mouse IgG2a, kappa

Sign In for Pricing

View Details

MBS489356-02 5x 0.2 mg

Anti-CD20 [1F5], Mouse IgG2a, kappa

Sign In for Pricing

View Details

PV149128 500 ng

4930444G20Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing

View Details