What is the catalog number for AVPR2 Peptide - C-terminal region?

The catalog number for AVPR2 Peptide - C-terminal region is orb2011628.

What sizes are available for AVPR2 Peptide - C-terminal region?

AVPR2 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is AVPR2 Peptide - C-terminal region in stock?

AVPR2 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

AVPR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ADHR, DI1, DIR, DIR3, MGC126533, MGC138386, NDI, V2R

UniProt

P30518

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000045

Preservative

Lyophilized powder

AA Sequence

NPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NB110-60547CL1 0.1 mL

Rabbit Polyclonal STIM1 Antibody [CoraFluor 1]

Sign In for Pricing

View Details

NBP1-78403JF549 0.1 mL

Rabbit Polyclonal 5-HT4 Antibody [Janelia Fluor 549]

Sign In for Pricing

View Details

K0512702 1.0 µg DNA

CRYGFP sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing

View Details

T8250-03C-PE 100 µL

Transforming Growth Factor alpha (TGFa) (PE)

Sign In for Pricing

View Details

TRC-A191225-100MG 100 mg

Acronycine

Sign In for Pricing

View Details

MBS8504631-01 0.1 mL

KRAS Antibody

Sign In for Pricing

View Details