Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AXL Peptide - C-terminal region

AXL Peptide - C-terminal region

Product Specifications

Product Name Alternative

JTK11, UFO

UniProt

P30530

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AXL Rabbit Polyclonal Antibody (orb584194) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001690

Preservative

Lyophilized powder

AA Sequence

QPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tlx3 Mouse Gene Knockout Kit (CRISPR)
KN517635 1 Kit

Tlx3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATP2B3 (NM_001001344) Human Over-expression Lysate
LY424329 100 µg

ATP2B3 (NM_001001344) Human Over-expression Lysate

Sign In for Pricing
View Details
HLA-DOB Polyclonal Antibody
E-AB-90358-01 60 µL

HLA-DOB Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DOB Polyclonal Antibody
E-AB-90358-02 120 µL

HLA-DOB Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DOB Polyclonal Antibody
E-AB-90358-03 200 µL

HLA-DOB Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013T-01 50 Tests

Elab Fluor® Violet 610 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details