AXUD1 Peptide - middle region
AXUD1 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp566F164, FAM130B, TAIP-3, URAX1, AXUD1, CSRNP-1
UniProt
D6RBU1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AXUD1 Rabbit Polyclonal Antibody (orb583670) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_149016
Preservative
Lyophilized powder
AA Sequence
ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4723108 1.0 µg DNA
Gpr172b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details 
PC1002873-01 100 mg
(S) -1- (6- (4-Fluoro-1H-pyrazol-1-yl) pyridin-3-yl) ethanamine
Sign In for Pricing
View Details PC1002873-02 250 mg
(S) -1- (6- (4-Fluoro-1H-pyrazol-1-yl) pyridin-3-yl) ethanamine
Sign In for Pricing
View Details PC1002873-03 1 g
(S) -1- (6- (4-Fluoro-1H-pyrazol-1-yl) pyridin-3-yl) ethanamine
Sign In for Pricing
View Details