AXUD1 Peptide - middle region
AXUD1 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp566F164, FAM130B, TAIP-3, URAX1, AXUD1, CSRNP-1
UniProt
D6RBU1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AXUD1 Rabbit Polyclonal Antibody (orb583670) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_149016
Preservative
Lyophilized powder
AA Sequence
ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15097422 1 Vial
Lentiviral human ANGPTL8 shRNA (UAS) - Lentiviral human ANGPTL8 shRNA (UAS) (100)
Sign In for Pricing
View Details MBS1334645-01 0.02 mg (E-Coli)
Recombinant Salmonella typhimurium UPF0225 protein ychJ (ychJ)
Sign In for Pricing
View Details MBS1334645-02 0.1 mg (E-Coli)
Recombinant Salmonella typhimurium UPF0225 protein ychJ (ychJ)
Sign In for Pricing
View Details MBS1334645-03 0.02 mg (Yeast)
Recombinant Salmonella typhimurium UPF0225 protein ychJ (ychJ)
Sign In for Pricing
View Details MBS1334645-04 0.1 mg (Yeast)
Recombinant Salmonella typhimurium UPF0225 protein ychJ (ychJ)
Sign In for Pricing
View Details MBS1334645-05 0.02 mg (Baculovirus)
Recombinant Salmonella typhimurium UPF0225 protein ychJ (ychJ)
Sign In for Pricing
View Details