Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AZI2 Peptide - middle region

AZI2 Peptide - middle region

Product Specifications

Product Name Alternative

AZ2, NAP1, TILP

UniProt

Q9H6S1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AZI2 Rabbit Polyclonal Antibody (orb585412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071906

Preservative

Lyophilized powder

AA Sequence

HGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBP1 (Center) Rabbit Polyclonal Antibody
AP17361PU-N 400 µL

FBP1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), Biotin conjugate, 0.1mg/mL
BNCB3439-500 1x 500 µL

Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STXBP3 Antibody
KC-28781-01 50 μL

STXBP3 Antibody

Sign In for Pricing
View Details
STXBP3 Antibody
KC-28781-02 100 µL

STXBP3 Antibody

Sign In for Pricing
View Details
STXBP3 Antibody
KC-28781-03 1 mL

STXBP3 Antibody

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (31A3), CF568 conjugate, 0.1mg/mL
BNC680046-100 1x 100 µL

Pgp9.5 (UCHL-1) (31A3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details