Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AZI2 Peptide - middle region

AZI2 Peptide - middle region

Product Specifications

Product Name Alternative

AZ2, NAP1, TILP

UniProt

Q9H6S1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AZI2 Rabbit Polyclonal Antibody (orb585412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071906

Preservative

Lyophilized powder

AA Sequence

HGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmin Antibody
KC-19193-01 50 μL

Desmin Antibody

Sign In for Pricing
View Details
Desmin Antibody
KC-19193-02 100 µL

Desmin Antibody

Sign In for Pricing
View Details
Desmin Antibody
KC-19193-03 1 mL

Desmin Antibody

Sign In for Pricing
View Details
Prpsap2 Mouse Gene Knockout Kit (CRISPR)
KN513986 1 Kit

Prpsap2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Histone H3 (phospho S10) Antibody
RC-16339-01 50 μL

Recombinant Histone H3 (phospho S10) Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 (phospho S10) Antibody
RC-16339-02 100 µL

Recombinant Histone H3 (phospho S10) Antibody

Sign In for Pricing
View Details