Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B230358A15Rik Peptide - middle region

B230358A15Rik Peptide - middle region

Product Specifications

Product Name Alternative

HSF 3, mHSF3, HSTF 3, B230358A15Rik, RP23-348N10.1

UniProt

Q8BL67

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B230358A15Rik Rabbit Polyclonal Antibody (orb324714) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766519

Preservative

Lyophilized powder

AA Sequence

EDKYKSLLDRVMPILKESKKLISSGDQPSGDDGEHPKVPVQDKPMNEESL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon: right
CS620996 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
CPXM1 Antibody
KC-7449-01 50 μL

CPXM1 Antibody

Sign In for Pricing
View Details
CPXM1 Antibody
KC-7449-02 100 µL

CPXM1 Antibody

Sign In for Pricing
View Details
CPXM1 Antibody
KC-7449-03 1 mL

CPXM1 Antibody

Sign In for Pricing
View Details
Cyclohexylacetaldehyde (~90%)
TRC-C991210-500MG 500 mg

Cyclohexylacetaldehyde (~90%)

Sign In for Pricing
View Details
Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D2]
TA501171AM 100 µL

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D2]

Sign In for Pricing
View Details