Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3gat2 Peptide - C-terminal region

B3gat2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GlcAT-S, Glcats, KIAA1963

UniProt

P59270

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B3gat2 Rabbit Polyclonal Antibody (orb581033) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_742122

Preservative

Lyophilized powder

AA Sequence

SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1A Recombinant Protein
OPCD04325-10UG 10 µg

IL1A Recombinant Protein

Sign In for Pricing
View Details
PGM3 Rabbit pAb
orb2718385-01 50 µL

PGM3 Rabbit pAb

Sign In for Pricing
View Details
PGM3 Rabbit pAb
orb2718385-02 100 µL

PGM3 Rabbit pAb

Sign In for Pricing
View Details
Ku80 Recombinant Antibody, PE Conjugated
bsm-52512R-PE 100 µL

Ku80 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Zinc finger protein 251 (ZNF251) Rabbit Polyclonal Antibody
TA355912 100 µL

Zinc finger protein 251 (ZNF251) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Interleukin 7 Receptor (IL7R)
MBS2060447-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Interleukin 7 Receptor (IL7R)

Sign In for Pricing
View Details