Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GAT3 Peptide - N-terminal region

B3GAT3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GLCATI, GlcAT-I

UniProt

O94766

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B3GAT3 Rabbit Polyclonal Antibody (orb579907) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036332

Preservative

Lyophilized powder

AA Sequence

PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PDX1 Protein, His (Fc)-Avi-tagged
PDX1-1642H 50 µg

Recombinant Human PDX1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
UCH37 (UCHL5) (NM_015984) Human Mass Spec Standard
PH302126 10 µg

UCH37 (UCHL5) (NM_015984) Human Mass Spec Standard

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Probable phosphatase YcdX (ycdX)
MBS1298675-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi A Probable phosphatase YcdX (ycdX)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Probable phosphatase YcdX (ycdX)
MBS1298675-02 0.1 mg (E-Coli)

Recombinant Salmonella paratyphi A Probable phosphatase YcdX (ycdX)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Probable phosphatase YcdX (ycdX)
MBS1298675-03 0.02 mg (Yeast)

Recombinant Salmonella paratyphi A Probable phosphatase YcdX (ycdX)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Probable phosphatase YcdX (ycdX)
MBS1298675-04 0.1 mg (Yeast)

Recombinant Salmonella paratyphi A Probable phosphatase YcdX (ycdX)

Sign In for Pricing
View Details