Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GAT3 Peptide - N-terminal region

B3GAT3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GLCATI, GlcAT-I

UniProt

O94766

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B3GAT3 Rabbit Polyclonal Antibody (orb579907) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036332

Preservative

Lyophilized powder

AA Sequence

PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gastrin (GAST/2631), CF594 conjugate, 0.1mg/mL
BNC942631-100 1x 100 µL

Gastrin (GAST/2631), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chicken Putative glycerol kinase 5, GK5 ELISA Kit
MBS9340304 Inquire

Chicken Putative glycerol kinase 5, GK5 ELISA Kit

Sign In for Pricing
View Details
Human AK 1 Protein
orb1475526-01 50 µg

Human AK 1 Protein

Sign In for Pricing
View Details
Human AK 1 Protein
orb1475526-02 500 µg

Human AK 1 Protein

Sign In for Pricing
View Details
Human MRPL43 (NM_176792) AAV Particle
RC208068A1V 250 µL

Human MRPL43 (NM_176792) AAV Particle

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-7977 Vector
mh32534 500 ng

LentimiRa-Off-hsa-miR-7977 Vector

Sign In for Pricing
View Details