Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALT2 Peptide - middle region

B4GALT2 Peptide - middle region

Product Specifications

Product Name Alternative

B4Gal-T2, B4Gal-T3, beta4Gal-T2

UniProt

O60909

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B4GALT2 Rabbit Polyclonal Antibody (orb579195) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005417

Preservative

Lyophilized powder

AA Sequence

RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Corynebacterium glutamicum ATP synthase subunit b (atpF), partial
MBS7053828 Inquire

Recombinant Corynebacterium glutamicum ATP synthase subunit b (atpF), partial

Sign In for Pricing
View Details
USP30 Lentiviral Activation Particles (h)
sc-407851-LAC 200 µL

USP30 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Ear6 CRISPR Activation Plasmid (m2)
sc-430027-ACT-2 20 µg

Ear6 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
MXD1 Rabbit pAb
A3613-01 20 µL

MXD1 Rabbit pAb

Sign In for Pricing
View Details
MXD1 Rabbit pAb
A3613-02 100 μL

MXD1 Rabbit pAb

Sign In for Pricing
View Details
MXD1 Rabbit pAb
A3613-03 500 μL

MXD1 Rabbit pAb

Sign In for Pricing
View Details