B4GALT2 Peptide - middle region
B4GALT2 Peptide - middle region
Product Specifications
Product Name Alternative
B4Gal-T2, B4Gal-T3, beta4Gal-T2
UniProt
O60909
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with B4GALT2 Rabbit Polyclonal Antibody (orb579195) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005417
Preservative
Lyophilized powder
AA Sequence
RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MLK1 Antibody [M13M22]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
VPK-109-T 20 Assays
QuickTiter™ Adenovirus Titer Immunoassay Kit, Trial Size
Sign In for Pricing
View Details GTR10350570 96 Well
Chicken Olfactory receptor 1G1 (OR1G1) ELISA Kit
Sign In for Pricing
View Details 
M9530-01B 200 µL
MuSK (Muscle Skeletal Receptor Tyrosine Kinase, MGC126323, MGC126324, Muscle Specific Kinase Receptor, Muscle Specific Tyrosine Protein Kinase Receptor, Receptor Tyrosine Kinase MuSK, Skeletal Muscle Receptor Tyrosine Kinase)
Sign In for Pricing
View Details