Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALT2 Peptide - middle region

B4GALT2 Peptide - middle region

Product Specifications

Product Name Alternative

B4Gal-T2, B4Gal-T3, beta4Gal-T2

UniProt

O60909

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B4GALT2 Rabbit Polyclonal Antibody (orb579196) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005417

Preservative

Lyophilized powder

AA Sequence

AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-human HGF / SF (Rilotumumab Biosimilar)
orb2828963-01 1 mg

Anti-human HGF / SF (Rilotumumab Biosimilar)

Sign In for Pricing
View Details
Anti-human HGF / SF (Rilotumumab Biosimilar)
orb2828963-02 5 mg

Anti-human HGF / SF (Rilotumumab Biosimilar)

Sign In for Pricing
View Details
Anti-human HGF / SF (Rilotumumab Biosimilar)
orb2828963-03 20 mg

Anti-human HGF / SF (Rilotumumab Biosimilar)

Sign In for Pricing
View Details
Anti-MEF2A (Phospho-Thr312)
orb1140182 100 µg

Anti-MEF2A (Phospho-Thr312)

Sign In for Pricing
View Details
SalI-HF, conc.
R3138T 2000 Units

SalI-HF, conc.

Sign In for Pricing
View Details
K114
MBS387796-01 2 mg

K114

Sign In for Pricing
View Details