Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALT2 Peptide - middle region

B4GALT2 Peptide - middle region

Product Specifications

Product Name Alternative

B4Gal-T2, B4Gal-T3, beta4Gal-T2

UniProt

O60909

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B4GALT2 Rabbit Polyclonal Antibody (orb579196) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005417

Preservative

Lyophilized powder

AA Sequence

AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BC080695-set siRNA/shRNA/RNAi Lentivector (Mouse)
13189094 4x 500 ng

BC080695-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
SLC30A1 Rabbit Polyclonal Antibody (HRP)
orb2119853 100 µL

SLC30A1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
C18orf19 sgRNA CRISPR Lentivector (Human) (Target 3)
K0323904 1.0 µg DNA

C18orf19 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
NDUFB5 (NM_001199957) Human Tagged ORF Clone
RC231781 10 µg

NDUFB5 (NM_001199957) Human Tagged ORF Clone

Sign In for Pricing
View Details
Serpinb10-ps Protein Lysate (Mouse) with C-HA Tag
43466035 100 µg

Serpinb10-ps Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Polyclonal Anti-TLR7 Antibody
GWB-BBP608 0.1 mg

Polyclonal Anti-TLR7 Antibody

Sign In for Pricing
View Details