Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4galt5 Peptide - C-terminal region

B4galt5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

9430078I07Rik, AW049941, AW539721

UniProt

Q9JMK0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B4galt5 Rabbit Polyclonal Antibody (orb579807) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062809

Preservative

Lyophilized powder

AA Sequence

GYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amtolmetin Guacil
TRC-A635350-1G 1 g

Amtolmetin Guacil

Sign In for Pricing
View Details
WASL Rabbit Polyclonal Antibody
ER1803-16 100 µL

WASL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(E)-2-Thiopheneacrylic Acid
TRC-T344815-25G 25 g

(E)-2-Thiopheneacrylic Acid

Sign In for Pricing
View Details
Rat Apoptosis Inducing Factor (AIF) ELISA Kit
RD-AIF-Ra-01 96 Tests

Rat Apoptosis Inducing Factor (AIF) ELISA Kit

Sign In for Pricing
View Details
Rat Apoptosis Inducing Factor (AIF) ELISA Kit
RD-AIF-Ra-02 48 Tests

Rat Apoptosis Inducing Factor (AIF) ELISA Kit

Sign In for Pricing
View Details
Carboxylated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
MGB04F2-COOH 10x 96 Well Plates

Carboxylated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS

Sign In for Pricing
View Details