Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4galt5 Peptide - C-terminal region

B4galt5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

9430078I07Rik, AW049941, AW539721

UniProt

Q9JMK0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B4galt5 Rabbit Polyclonal Antibody (orb579807) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062809

Preservative

Lyophilized powder

AA Sequence

GYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phloroglucinol Glucuronide Sodium Salt
TRC-P340015-5MG 5 mg

Phloroglucinol Glucuronide Sodium Salt

Sign In for Pricing
View Details
Cig2 (3A11/5), CF594 conjugate, 0.1mg/mL
BNC942827-100 1x 100 µL

Cig2 (3A11/5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3Alpha,17,20Beta-Trihydroxy-5Beta-pregnan-11-one
TRC-T795270-1MG 1 mg

3Alpha,17,20Beta-Trihydroxy-5Beta-pregnan-11-one

Sign In for Pricing
View Details
Apopt1 (NM_026511) Mouse Tagged ORF Clone
MG201850 10 µg

Apopt1 (NM_026511) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS503207 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Uridine 5’-Triphosphate-13C,15N2 Sodium Salt
TRC-U830056-2.5MG 2.5 mg

Uridine 5’-Triphosphate-13C,15N2 Sodium Salt

Sign In for Pricing
View Details