Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC25 Peptide - middle region

DNAJC25 Peptide - middle region

Product Specifications

Product Name Alternative

BA16L21.2.1

UniProt

Q9H1X3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC25 Rabbit Polyclonal Antibody (orb579257) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001015882

Preservative

Lyophilized powder

AA Sequence

RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd209e sgRNA CRISPR Lentivector set (Mouse)
K4109601 3x 1.0 µg

Cd209e sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD564057 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
NCDN Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV696509 1.0 µg DNA

NCDN Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Gm16381 Protein Vector (Mouse) (pPM-C-HA)
21919024 500 ng

Gm16381 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Cyanine3.5 carboxylic acid
T205860-01 1 mg

Cyanine3.5 carboxylic acid

Sign In for Pricing
View Details
Cyanine3.5 carboxylic acid
T205860-02 5 mg

Cyanine3.5 carboxylic acid

Sign In for Pricing
View Details