Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC25 Peptide - middle region

DNAJC25 Peptide - middle region

Product Specifications

Product Name Alternative

BA16L21.2.1

UniProt

Q9H1X3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC25 Rabbit Polyclonal Antibody (orb579257) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001015882

Preservative

Lyophilized powder

AA Sequence

RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAT3A / CBP Polyclonal Antibody, PerCP Conjugated
bs-1397R-PerCP 100 µL

KAT3A / CBP Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
ABHD5 Protein Vector (Human) (pPB-C-His)
PV000193 500 ng

ABHD5 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
OLR694 Adenovirus (Rat)
34604056 1.0 mL

OLR694 Adenovirus (Rat)

Sign In for Pricing
View Details
Anti-TIGIT antibody (DM178), Rabbit mAb
12-9350-100 100 µg

Anti-TIGIT antibody (DM178), Rabbit mAb

Sign In for Pricing
View Details
Anti-CD30  (3B9)
YF-MA12326 100 ug

Anti-CD30 (3B9)

Sign In for Pricing
View Details
Kcng3 3'UTR Lenti-reporter-Luc Vector
25357084 1.0 µg

Kcng3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details