Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bace1 Peptide - middle region

Bace1 Peptide - middle region

Product Specifications

Product Name Alternative

C76936

UniProt

P56818

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_035922

Preservative

Lyophilized powder

AA Sequence

YTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC33 (C-term) Rabbit Polyclonal Antibody
AP50752PU-N 400 µL

CCDC33 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CAB39L (NM_001079670) Human Over-expression Lysate
LC421532 20 µg

CAB39L (NM_001079670) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Formyl Rifamycin
TRC-F700950-1G 1 g

3-Formyl Rifamycin

Sign In for Pricing
View Details
Human TEM1 (CD248) activation kit by CRISPRa
GA111389 1 Kit

Human TEM1 (CD248) activation kit by CRISPRa

Sign In for Pricing
View Details
Pan Hu Antibody
KC-20945-01 50 μL

Pan Hu Antibody

Sign In for Pricing
View Details
Pan Hu Antibody
KC-20945-02 100 µL

Pan Hu Antibody

Sign In for Pricing
View Details