Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAD Peptide - middle region

BAD Peptide - middle region

Product Specifications

Product Name Alternative

BBC2, BCL2L8

UniProt

Q92934

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BAD Rabbit Polyclonal Antibody (orb573612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004313

Preservative

Lyophilized powder

AA Sequence

GAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGREL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADHFE1 (NM_144650) Human 3' UTR Clone
SC206359 10 µg

ADHFE1 (NM_144650) Human 3' UTR Clone

Sign In for Pricing
View Details
SIRT5 Peptide
MBS3225943-01 0.1 mg

SIRT5 Peptide

Sign In for Pricing
View Details
SIRT5 Peptide
MBS3225943-02 5x 0.1 mg

SIRT5 Peptide

Sign In for Pricing
View Details
WDR45L (WDR45B) (NM_019613) Human Tagged Lenti ORF Clone
RC203196L4 10 µg

WDR45L (WDR45B) (NM_019613) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SLC6A8 Polyclonal Antibody
orb1412160 100 µL

SLC6A8 Polyclonal Antibody

Sign In for Pricing
View Details
Monkey Hepatitis B surface Antigen ELISA kit
GTR10384836 96 Well

Monkey Hepatitis B surface Antigen ELISA kit

Sign In for Pricing
View Details