Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAG1 Peptide - N-terminal region

BAG1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HAP, RAP46

UniProt

Q99933

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BAG1 Rabbit Polyclonal Antibody (orb585660) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001165886

Preservative

Lyophilized powder

AA Sequence

LIFKGKSLKEMETPLSALGIQDGCRVMLIGKKNSPQEEVELKKLKHLEKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgG1 (Gamma 1 chain) ATTO 532 Conjugated Antibody
TA397871 500 µg

Mouse IgG1 (Gamma 1 chain) ATTO 532 Conjugated Antibody

Sign In for Pricing
View Details
Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit
E-EL-M1292-01 24 Tests

Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit

Sign In for Pricing
View Details
Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit
E-EL-M1292-02 48 Tests

Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit

Sign In for Pricing
View Details
Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit
E-EL-M1292-03 96 Tests

Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit

Sign In for Pricing
View Details
2,2',4,4',6,6'-Hexabromo-bibenzyl
TRC-H281405-25MG 25 mg

2,2',4,4',6,6'-Hexabromo-bibenzyl

Sign In for Pricing
View Details
EMC2 Antibody
OC-2455-01 50 μL

EMC2 Antibody

Sign In for Pricing
View Details