Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAG5 Peptide - C-terminal region

BAG5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BAG-5

UniProt

Q9UL15

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BAG5 Rabbit Polyclonal Antibody (orb331160) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001015049

Preservative

Lyophilized powder

AA Sequence

LEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPEG (Striated Muscle Preferentially Expressed Protein Kinase, Aortic Preferentially Expressed Protein 1, APEG1, APEG-1, KIAA1297) (APC)
133758-APC 100 µL

SPEG (Striated Muscle Preferentially Expressed Protein Kinase, Aortic Preferentially Expressed Protein 1, APEG1, APEG-1, KIAA1297) (APC)

Sign In for Pricing
View Details
Recombinant Pseudanabaena sp. Phycocyanobilin lyase subunit alpha (cpcE1)
MBS1447485-01 0.02 mg (E-Coli)

Recombinant Pseudanabaena sp. Phycocyanobilin lyase subunit alpha (cpcE1)

Sign In for Pricing
View Details
Recombinant Pseudanabaena sp. Phycocyanobilin lyase subunit alpha (cpcE1)
MBS1447485-02 0.02 mg (Yeast)

Recombinant Pseudanabaena sp. Phycocyanobilin lyase subunit alpha (cpcE1)

Sign In for Pricing
View Details
Recombinant Pseudanabaena sp. Phycocyanobilin lyase subunit alpha (cpcE1)
MBS1447485-03 0.1 mg (E-Coli)

Recombinant Pseudanabaena sp. Phycocyanobilin lyase subunit alpha (cpcE1)

Sign In for Pricing
View Details
Recombinant Pseudanabaena sp. Phycocyanobilin lyase subunit alpha (cpcE1)
MBS1447485-04 0.1 mg (Yeast)

Recombinant Pseudanabaena sp. Phycocyanobilin lyase subunit alpha (cpcE1)

Sign In for Pricing
View Details
Recombinant Pseudanabaena sp. Phycocyanobilin lyase subunit alpha (cpcE1)
MBS1447485-05 0.02 mg (Baculovirus)

Recombinant Pseudanabaena sp. Phycocyanobilin lyase subunit alpha (cpcE1)

Sign In for Pricing
View Details