Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAG5 Peptide - C-terminal region

BAG5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BAG-5

UniProt

Q9UL15

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BAG5 Rabbit Polyclonal Antibody (orb331160) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001015049

Preservative

Lyophilized powder

AA Sequence

LEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Demonstration Transparent Components - Potentiometer
1100750/18 1 Each

Demonstration Transparent Components - Potentiometer

Sign In for Pricing
View Details
Tet2 Immunizing Peptide
MBS427670-01 0.1 mg

Tet2 Immunizing Peptide

Sign In for Pricing
View Details
Tet2 Immunizing Peptide
MBS427670-02 5x 0.1 mg

Tet2 Immunizing Peptide

Sign In for Pricing
View Details
RPS4XP3 Protein Vector (Human) (pPM-C-HA)
42570021 500 ng

RPS4XP3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
KCNC1 Protein Vector (Mouse) (pPB-N-His)
PV193287 500 ng

KCNC1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Chromobox Protein Homolog 5 (CBX5) Antibody
abx324726-01 50 µg

Chromobox Protein Homolog 5 (CBX5) Antibody

Sign In for Pricing
View Details