Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAG5 Peptide - C-terminal region

BAG5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BAG-5

UniProt

Q9UL15

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BAG5 Rabbit Polyclonal Antibody (orb331160) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001015049

Preservative

Lyophilized powder

AA Sequence

LEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC3A2, CT (SLC3A2, MDU1, 4F2 cell-surface antigen heavy chain, 4F2 heavy chain antigen, Lymphocyte activation antigen 4F2 large subunit, CD98) (MaxLight 550)
MBS6348436-01 0.1 mL

SLC3A2, CT (SLC3A2, MDU1, 4F2 cell-surface antigen heavy chain, 4F2 heavy chain antigen, Lymphocyte activation antigen 4F2 large subunit, CD98) (MaxLight 550)

Sign In for Pricing
View Details
SLC3A2, CT (SLC3A2, MDU1, 4F2 cell-surface antigen heavy chain, 4F2 heavy chain antigen, Lymphocyte activation antigen 4F2 large subunit, CD98) (MaxLight 550)
MBS6348436-02 5x 0.1 mL

SLC3A2, CT (SLC3A2, MDU1, 4F2 cell-surface antigen heavy chain, 4F2 heavy chain antigen, Lymphocyte activation antigen 4F2 large subunit, CD98) (MaxLight 550)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 4 Induced Protein 1 (IL4I1)
MBS2137466-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Interleukin 4 Induced Protein 1 (IL4I1)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 4 Induced Protein 1 (IL4I1)
MBS2137466-02 0.2 mL

Cy3 Linked Monoclonal Antibody to Interleukin 4 Induced Protein 1 (IL4I1)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 4 Induced Protein 1 (IL4I1)
MBS2137466-03 0.5 mL

Cy3 Linked Monoclonal Antibody to Interleukin 4 Induced Protein 1 (IL4I1)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 4 Induced Protein 1 (IL4I1)
MBS2137466-04 1 mL

Cy3 Linked Monoclonal Antibody to Interleukin 4 Induced Protein 1 (IL4I1)

Sign In for Pricing
View Details